DPCstruct | MC46083
Metacluster Properties and Pfam Annotations
| Number of structural domains | 135 |
|---|---|
| Mean domain length (aa) | 131 ± 24 aa |
| Standard deviation of domain lengths | 23.77 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20710 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E7FVI0 | 4-116 | QIKEPHPHDVLSGRGNYVNYHDGNEYFRKMVRDHKVDYVNCPKQQKGKFSKLIVDKIKQRNPPGRFLKQVKDSKLWYDIGEKKALDK… |
| A0A6T6EIE5 | 91-211 | AVELPSRSDVLLGRGKPNQAHAGNKYLHDVIASKYEQYDMSSRREKTKIATDLVQSIKDASGRFLKRDENDIWMEVDDHTAREKVCH… |
| A0A448ZR34 | 385-499 | None |
| A0A448ZPG1 | 8-150 | None |
| A0A448ZGV6 | 77-190 | None |
| A0A448ZFP7 | 325-459 | None |
| A0A448ZAL2 | 15-170 | None |
| A0A448YXU1 | 254-418 | None |
| A0A7S2IHF2 | 5-118 | None |
| A0A7S0Y7F2 | 266-423 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.