DPCstruct | MC4608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 152 ± 19 aa |
| Standard deviation of domain lengths | 18.62 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7JIX2 | 1-141 | MNGIIEDRTSVSSADILDADALHGPNNAARFSHILQKDAFLVFRSLCKLSMKPLADGPPDPKSHELRSKIVSLQLLLSVLQGAGPVF… |
| A0A7R8H8L2 | 202-341 | KDTDSHRAVTPLISELIDKVIDPTEEHTHIHKVLQNDCFLVLRSLCKLSIAPIPSDETSDNKSHGLRSKILSLHLLLSILQNGGETF… |
| A0A820AJ38 | 15-146 | None |
| A0A4U5PCD2 | 236-392 | None |
| A0A448X7G7 | 1-162 | None |
| Q7K783 | 236-374 | None |
| A0A3P7DC22 | 382-560 | None |
| A0A822APA8 | 1-136 | None |
| A0A1S3LGA0 | 334-520 | None |
| A0A182SCN9 | 162-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.