DPCstruct | MC46074
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 186 ± 46 aa |
| Standard deviation of domain lengths | 46.06 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 92.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.88 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0044- PF06243 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3ML00 | 34-172 | NVKLIEQPNGDFAQTILKQYFLSTFNCLLYGALSHSKDETLAAIAAKSLKEVLYHKRHSAEWLKRLGDGTAESKQRMEFALEELWTY… |
| A0A2V6S2B4 | 16-198 | RHATVMYGLLADLGVDVGGHVSAHDEIFTMRVAADADIGTERITSDKRVNIFYYPIDTWADFIFFNFCMDRGAGHQLEDVRHCSYGP… |
| A0A6I4KMV3 | 59-231 | None |
| A0A7W1V013 | 1-136 | None |
| A0A7Y5G840 | 2-144 | None |
| A0A838F1X9 | 23-162 | None |
| A0A7V5RHI9 | 2-115 | None |
| A0A7V4HDY3 | 6-131 | None |
| A0A6I1J028 | 3-127 | None |
| A0A377M302 | 17-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.