DPCstruct | MC46071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 183 |
|---|---|
| Mean domain length (aa) | 134 ± 19 aa |
| Standard deviation of domain lengths | 19.32 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04892 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X3WJA0 | 3-127 | KWKYWIPPLLYMALIFIVSSLEQPPIPPPKFEWIGIDKLLHFIEYGILSVLLTIAFVNASPSWFPARLIWVTAALISILYGASDEIH… |
| A1K4W4 | 2-97 | RAAFALALIVVFWLAVQPAPDIVQLFSWQDKAEHALLFAALAALGFAAWPQRAAAVVVGLLAYGAAMEVAQSFTAFRVGDPWDWLAD… |
| A0A354CW42 | 18-131 | None |
| A0A2T8HW44 | 33-149 | None |
| A0A3A0BA95 | 6-135 | None |
| F0K1A1 | 3-105 | None |
| C5TAR0 | 6-127 | None |
| A0A2R6D995 | 10-121 | None |
| A0A2N1Q5U6 | 6-147 | None |
| A0A4R7DYF0 | 1-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.