DPCstruct | MC46069
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 143 ± 14 aa |
| Standard deviation of domain lengths | 13.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 27.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06146 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A076HQY3 | 4-147 | PSRSKRTFLGLVDAGEREVARLLTLITAVVISAAIIQLMISLGSKLLTGSAATWLGDDLIKILGDLLTVLIALEVLQNITSYLRRHV… |
| A0A0U5HQK8 | 3-138 | VDDHVRITERLIQSVEIVAAYVLVLLFAVGVFDLGLTIFDLVRTGAITQTSEVIALIDTVLLLFIIVEIYQTVVAYTREESVVRIVI… |
| A0A843CT37 | 10-174 | None |
| A0A4P5VKC4 | 99-238 | None |
| A0A6P1DM27 | 10-154 | None |
| F8XQI6 | 2-123 | None |
| E1F2I3 | 107-265 | None |
| A0A2U1IU59 | 35-182 | None |
| A0A3R9T150 | 9-148 | None |
| A0A0D6PGE5 | 12-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.