DPCstruct | MC46063
Metacluster Properties and Pfam Annotations
| Number of structural domains | 108 |
|---|---|
| Mean domain length (aa) | 318 ± 77 aa |
| Standard deviation of domain lengths | 76.66 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 78.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.10 |
| Pfam Score | 96.30 |
| Assigned Pfam label(s) | CL0182- PF03105- CL0149 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L7IUZ4 | 534-856 | ALLSTTLAATLLLFWALTRRDPALVVYYDWIPMTYLLVLAALFAVPLRGGAMPTSGRRRLLATLRRVSLGGIAEAQNGKFGDILLAD… |
| A0A4S4KPG5 | 3-218 | RVEFADFWMGDQFCSLIFPLSNLYFVACAYTRGFDNDSDWQQCLVTKDWGVPFVLASIPLLVRLVQSIKRWVDSRLITHLINGGKYG… |
| J4U5D8 | 35-488 | None |
| A0A177W8S8 | 74-450 | None |
| A0A7J6LH01 | 730-1078 | None |
| A0A7N0V522 | 141-433 | None |
| A0A7N0V4P2 | 199-543 | None |
| A0A2H2JAZ5 | 2-280 | None |
| A0A4S8ITJ9 | 74-410 | None |
| A0A0V0QUL5 | 4-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.