DPCstruct | MC46060
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 127 ± 19 aa |
| Standard deviation of domain lengths | 18.86 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.76 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0418- PF11149- PF00239 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I5GXG5 | 6-125 | VIIAKMETEPTAVLRERWHRLVGGPAPRVSPKMLRLALAWEIQARASGGLSRSCSRTLDQVGRAQTRTRTAVAGTRLVREWGGRVHV… |
| A0A401K3M2 | 2-92 | AMDRAVLGERWRQVFGHPAPAKCRAEFLRQALGWQMQADIHGGLSAVDRHHLLRGTSSAAPKLATGSHLIQVWQGETHQVTVLEEGY… |
| A0A5C5Z0U0 | 1-150 | None |
| A0A2A4QTQ1 | 18-143 | None |
| A0A192IKQ4 | 16-117 | None |
| A0A3D2LKD1 | 92-215 | None |
| A0A7D8YDR9 | 83-252 | None |
| A0A2T4YY71 | 13-161 | None |
| A0A7W8J822 | 21-159 | None |
| A0A519HIW8 | 6-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.