DPCstruct | MC46053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 163 ± 44 aa |
| Standard deviation of domain lengths | 44.02 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 74.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4GU95 | 19-149 | GPLRQGTWTEAEVAYVALLSKFFKAGLLECVEPGHSIRKWLASIIKCDPMRISKRLTKSARLGIVPYKRNQPSLDAMSSFERRACLQ… |
| A0A836CDJ8 | 81-174 | ELRTGRWHHYETQYAQHLMEDFEAGTLPIGEGTKLATLLCRLLNCNQTRLSKKLKIGKRFYAHGPTRIRTPEAIAAHSVRQRRISEL… |
| A0A1V9YEU5 | 29-172 | None |
| A0A024G0P1 | 32-162 | None |
| K3XCD9 | 75-298 | None |
| A0A1V9YEY7 | 299-462 | None |
| K3WXB9 | 176-314 | None |
| A0A7S3ZNY1 | 19-159 | None |
| K3WLL1 | 4-134 | None |
| A0A067BTC3 | 2-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.