DPCstruct | MC46052
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 226 ± 33 aa |
| Standard deviation of domain lengths | 32.93 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.99 |
| Pfam Score | 98.57 |
| Assigned Pfam label(s) | CL0023- PF01730 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4GM61 | 12-233 | LPSCLLKMEWLVWQLADSMYPTGGFAHSQGLESAVQANIVHNSITLQAFLVTSLHQTANLLLPFVFVAHASATSLDSFVHLDSLAHA… |
| A0A650CXN8 | 2-189 | FKFQLFDSAFPIGSFNYSSAVEEAYARGINVIEFIKAVYKNVIIRGDLVMAKLAFTNPEQADKILYASKVTKELREMSVNMGRSIVY… |
| A0A1W0X929 | 3-223 | None |
| A0A4Q4Z6Y3 | 8-182 | None |
| K8E8S8 | 4-241 | None |
| A0A7D5MWK9 | 18-242 | None |
| A0A3D5JWL5 | 48-251 | None |
| L8GQ53 | 3-253 | None |
| A0A2U0TJM3 | 78-314 | None |
| A0A2N6TDV8 | 16-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.