DPCstruct | MC46051
Metacluster Properties and Pfam Annotations
| Number of structural domains | 108 |
|---|---|
| Mean domain length (aa) | 174 ± 30 aa |
| Standard deviation of domain lengths | 29.88 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.89 |
| Pfam Score | 91.00 |
| Assigned Pfam label(s) | CL0004- PF02026- PF06210 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4GD61 | 515-709 | QTHRPHPIDIQSVGLPPSLAGDLSTLAQQLHFQWCFDKLLVGWSYGAIRNDELKHHPLMKPFWELDAAAQARNRVSVEASLKCILAL… |
| A0A521T5D9 | 12-163 | INNGRYEDCAQMAHERWLKTKLGQGWSYGATRDGDAKQNPLMLPFTELPAHVQGINSLAPYAVANYLRTNKRDLSLEELAELIREIL… |
| A0A183SPW0 | 841-1049 | None |
| A0A1I6KMA4 | 478-642 | None |
| A0A7V6HJ63 | 121-274 | None |
| A0A3P7BZN9 | 34-241 | None |
| A0A1V1P853 | 55-169 | None |
| A0A366C542 | 11-125 | None |
| A0A7S3GF84 | 3-148 | None |
| A0A7S3GFB5 | 223-433 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.