DPCstruct | MC4605
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 90 ± 8 aa |
| Standard deviation of domain lengths | 7.98 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 35.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3Q878 | 27-114 | ELSCNALECMLTGLTNIYTDSSEYRREKLDQPFEKHLPIRDWAKVTDKKTFQLKWHIPTDEEFQLAYDVLDEFFYPELEKLTNADSLS |
| A0A183I6X4 | 9-103 | DTVSEMIFCAVRLSCSALECMLTGLTSIYTDTNEQRREKLDQPFEKYLPIRDWAKPADKKTFHLKWHIPTEEEFQLARDVLDEFFYP… |
| A0A0R3RN45 | 152-242 | None |
| J9EQC4 | 2-79 | None |
| J9EMP4 | 69-154 | None |
| A0A0M3IUZ5 | 9-91 | None |
| A0A820SVQ1 | 1-104 | None |
| A0A820KBW2 | 9-105 | None |
| A0A3P6R0Z2 | 99-176 | None |
| A0A818LQI1 | 118-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.