DPCstruct | MC46045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 134 ± 20 aa |
| Standard deviation of domain lengths | 19.93 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A367ABZ7 | 114-256 | LATAREGLEAALAPARKRLAIRVVRSDADVNAQSDTAVASCGDYDHNPRTGAKCSDSFLMCLRCANALAGPRHFPRIVCLHDAMENL… |
| A0A2N0GMZ3 | 13-109 | GLNTAWTACGDYDHHPATDLPCGDSFLDCFHCGNCLVTRSHLPYLLALLDALIDRNQEMDQEHWWQRYGPAWAAIRRDILAKFDPAE… |
| A0A386JAW7 | 181-314 | None |
| A0A7W9VGQ2 | 20-185 | None |
| A0A1V6MZ39 | 9-125 | None |
| A0A3E0BV84 | 1-107 | None |
| A0A2D7E401 | 568-690 | None |
| A0A1H0V2L4 | 23-177 | None |
| A0A3Z6QNM8 | 432-595 | None |
| A0A1X1WFZ1 | 20-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.