DPCstruct | MC46044
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 89 ± 12 aa |
| Standard deviation of domain lengths | 11.76 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 64.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0625 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484KD75 | 1-69 | MATETAAETVDAPAGAVVVDAPPSKQPHKLERKWTLWFDNQSKPKQGAAWGSSMRRVYTFDTVEEFWCL |
| A0A0D3DES2 | 1-95 | MAVEEEDTPKPVAEEPNAKSVEQPIDRYHEEGDDNEEGEIAGGEVDESSAVPESHPLEHSWTLWFDNPSVKSKQTTWGSSLRSVFTF… |
| A0A834ZUD2 | 1-99 | None |
| A0A803M838 | 1-88 | None |
| A0A2P2M829 | 14-108 | None |
| A0A822Z844 | 1-109 | None |
| A0A5N5KUY1 | 1-88 | None |
| A0A398AK39 | 1-93 | None |
| A0A2P6U2U7 | 133-220 | None |
| M1BFR6 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.