DPCstruct | MC46037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 90 ± 17 aa |
| Standard deviation of domain lengths | 17.38 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06823 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A537T5F9 | 156-252 | TETRSQTTGQAGAGAKLSTEQRTKITSVIRQQHVEPVQNVNFSISVGTRVPRDVRFHTLPSEIVTIYPEWRGYEYFLVRDQIVVVDP… |
| A0A527HCT9 | 4-74 | TPEQQTVVKEYVHKHPIASVNILGLELGVGSTVPDTVELREVPDVQYRYAVVNDRTVLIDPGTRRVIHVIE |
| A0A7X1M668 | 1-68 | None |
| A0A537TQR5 | 134-234 | None |
| A0A429YSH0 | 245-338 | None |
| A0A537T054 | 325-427 | None |
| A0A327JYV6 | 64-185 | None |
| A0A0F5FJF4 | 15-85 | None |
| A0A7Y4LXI1 | 1-107 | None |
| A0A0Q5WWM3 | 61-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.