DPCstruct | MC4603
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 406 ± 61 aa |
| Standard deviation of domain lengths | 60.52 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3MTL0 | 69-489 | LRIISTLHEVAFIQNLVFYIEAAYKVADYGMWERGDKTNQGIPELNTSSVGMAKAALEAIDELDLFGAHGGPKSVIHVLPDEVEHCQ… |
| A0A183I4Y3 | 46-428 | NSSSVGMVKAALQALNDVGDLFGDGSKGSVIHVLPDQIQQCAALLTSMLPRESFSKETDLALLSIISYPAFAVEEQSLIQLTRQTII… |
| A0A067RWI8 | 153-570 | None |
| A7RPX3 | 123-515 | None |
| A0A0L7L4P8 | 1-485 | None |
| A0A0B2VPZ9 | 318-618 | None |
| A0A1I8H7G0 | 9-502 | None |
| A0A0B1T8B7 | 2-331 | None |
| A0A2I0T9S5 | 10-350 | None |
| A0A0S7JRG9 | 153-573 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.