DPCstruct | MC46022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 99 ± 22 aa |
| Standard deviation of domain lengths | 22.22 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 91.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2REU3 | 2-76 | MLKIELRQHVGAPCKPIVEVGSEVKKGQLLAEPQGLGANIHSSVYGKVVDITDSAILIEADENQPEEFVKIKETE |
| A0A7V4NJN4 | 246-326 | QKFFLEPQIVKIFLSQHTGKPAQPIVKNNDKVYIGSKLASADGFISSNIHSSVSGKVLEIKEEFHPIIQKFLPAIIIENDG |
| A0A3D1Q9K9 | 14-85 | None |
| A0A1I0BL16 | 591-712 | None |
| A0A378F740 | 130-250 | None |
| A0A378BSE2 | 97-168 | None |
| A0A759YGN7 | 726-795 | None |
| A0A644XWQ9 | 174-244 | None |
| D4J362 | 22-124 | None |
| A0A7H4MDW7 | 7-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.