DPCstruct | MC4602
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 199 ± 6 aa |
| Standard deviation of domain lengths | 6.40 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 73.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 46.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06664 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K5REE5 | 250-438 | GYWKQVGPIAVGSFCLFIFDMCERGVQLTNPFYSIWTTDVGTELAMAFIIVAGICLCLYFLFLCFMVFQVFRNISGKQSSLPAMSKV… |
| A0A183I4H8 | 3-202 | ERGMQLLNPFFSIWSSELGSRLAYTQFTQHPIHVFQYTSIYTASFCVLCYFGFLSYKIYRVWITIKRKRAAQLYRNSEIRRLKVEAI… |
| F1LCD1 | 57-256 | None |
| A0A834ML25 | 88-294 | None |
| A0A1B0B943 | 345-534 | None |
| A0A2R7WAU7 | 1-207 | None |
| T1IN05 | 334-536 | None |
| A0A183BV57 | 335-532 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.