DPCstruct | MC46017
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 159 ± 25 aa |
| Standard deviation of domain lengths | 25.26 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07670 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2RCU7 | 2-145 | ALWMGVMNIAKDSGLISKIGNMLYPILKRLFPSIPKGHKAMSYIVMNIVLNMLGAGNGATAFGLKAMNELQTLNNKKDTATNDMVMF… |
| A0A1Z5HEM3 | 79-227 | ILPLIAYLAFFCGLMELLIISGATEKLAKVLSPVFVKVFPSIPKNHPSISYMTLNFAANFLGLDSAATPFGLKAMESLQEINPEKDK… |
| A0A812P3U1 | 58-229 | None |
| R6UV91 | 22-193 | None |
| Q3EJ91 | 2-122 | None |
| A0A136NLF2 | 185-345 | None |
| A0A3B8VD26 | 9-154 | None |
| A0A7V9NJ16 | 2-104 | None |
| B0MLB2 | 3-103 | None |
| A0A0P7Z0G0 | 137-307 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.