DPCstruct | MC46013
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 88 ± 5 aa |
| Standard deviation of domain lengths | 4.83 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 42.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0169 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0EDS7 | 1-90 | MWQEVYSFDNEWLKKQGLYDPKTKFLDEDKIKNAIRKSIEFSLEKSGMKETALWSGAIHYNTDNIHIHVAICEPNPTKKEVRGLKKR… |
| A0A0U2NNU8 | 41-131 | FKVAQENKSVLWRDVFSFDHEWLKEQRLLIGNQLNDKEIKKAVRKAMNECFDRENLNDTGFWVAEIHYNTDNIHVHVASSETINTRP… |
| G9QFS4 | 177-268 | None |
| A0A7K3JCM2 | 175-261 | None |
| A0A6M1W6T1 | 11-97 | None |
| A0A0F7RJE2 | 1-95 | None |
| A0A3P0Y5Q2 | 112-200 | None |
| A0A6M2Z7K5 | 93-182 | None |
| A0A200IDY7 | 144-224 | None |
| A0A2I1K6Y0 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.