DPCstruct | MC46010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 145 ± 18 aa |
| Standard deviation of domain lengths | 18.30 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645IKZ0 | 2-123 | SNFTKGKISYKMTVVIVCVVGVFQSVMGVEAIIKLAGPFFFACYPIAILLTILGLFKKYVPNEGAYKGSALLVILVSIMESLTVAGV… |
| T0E3N0 | 2-140 | TTSIGLVSATAQYFTKMSNGKVKYETIVVGVCIFSALVANFGVSAIIKFASPILTVIYPATIVLVLMTLFNNKIKNDNTFKGATYVA… |
| A0A7Y0N2S9 | 4-157 | None |
| A0A838WQ31 | 55-210 | None |
| A0A329EKW4 | 9-132 | None |
| C2MJF9 | 8-144 | None |
| A0A850QZ14 | 1-140 | None |
| A0A7X8K7B7 | 4-120 | None |
| A0A656SL72 | 2-151 | None |
| A0A3A1Y2S9 | 7-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.