DPCstruct | MC4601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 110 ± 8 aa |
| Standard deviation of domain lengths | 7.61 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7F6I4 | 1-100 | CAHLLLAHNAPVKVKNAQGWSPLAEAISYGDRQMITALLRKLKQQSRESVEEKRPRLLKALKELGDFYLELHWDFQSWVPLLSRILP… |
| A0A183I406 | 1-110 | MLAITLGHYECARALLEKGANAAIQNADMWSPSHEAICAGNSDLLRLIIQYRDYQRALQTSCAMERLLNLLKETSDFYAEMSWEFTS… |
| A0A2Y9R7W0 | 42-155 | None |
| A0A5J4NNJ7 | 1-114 | None |
| A0A7J7ZSZ2 | 149-263 | None |
| A0A822XTP6 | 81-195 | None |
| A0A0R3T438 | 2-90 | None |
| A0A5C7IUL3 | 62-172 | None |
| A0A0P4W7S1 | 92-205 | None |
| A0A0X3Q563 | 48-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.