DPCstruct | MC46003
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 83 ± 7 aa |
| Standard deviation of domain lengths | 6.57 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 52.57 |
| Pfam Score | 87.88 |
| Assigned Pfam label(s) | CL0139- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0CPW1 | 1-89 | MDGLITISSLDEIDVLLTAIVGMIGLVPTLEAIKKGKTIALANKETLVTAGQLVMEEARKRNVDILPVDSEHSAIFQCLNGENKKKL… |
| A0A2V2EX02 | 84-151 | DVALIAAGGFAGLAYTLRAARLGIKIALANKESLVCGGELVLNAVKKSGSDLVPVDSEHSALFQALSF |
| A0A7J6U9H5 | 419-501 | None |
| A0A7V5C3S6 | 76-156 | None |
| A0A811P1F4 | 196-278 | None |
| A0A835FZQ5 | 56-137 | None |
| A0A1Y5IQX7 | 2-80 | None |
| A0A2Z5QYJ2 | 108-193 | None |
| A0A6A5L6U5 | 1047-1126 | None |
| X8B4U2 | 88-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.