DPCstruct | MC46001
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 141 ± 14 aa |
| Standard deviation of domain lengths | 14.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.07 |
| Pfam Score | 71.98 |
| Assigned Pfam label(s) | PF03726- CL0329- PF03725 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0CLN1 | 1-133 | MMVEAGAEEIPDELMLEAILFAHEEIKKVVEFVEMIVAEVGKEKIEVTLYKIDEDVEKAVREFATDKMKEAVKTVEKLERMEKMDAV… |
| A0A099DDG8 | 3-140 | AVLMVESEADLLSEEQMLGAVVFGHDQQQIVIQNINELVKEAGKEKWDWQPEPVNQALNDRIAALAESRMGDAYRITEKQERYAQVD… |
| A0A447TUR3 | 3-117 | None |
| A0A1Q7C8B0 | 174-313 | None |
| A0A843U7B0 | 217-358 | None |
| A0A7E4SGL6 | 494-628 | None |
| E2BQX3 | 81-223 | None |
| X8F8R8 | 1-165 | None |
| A0A446KY41 | 25-138 | None |
| A0A024G5H3 | 230-382 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.