DPCstruct | MC46000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 109 ± 13 aa |
| Standard deviation of domain lengths | 12.61 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0CIN9 | 78-189 | QAKEDFKDLYNVNEDNIINNDNIWITKLEVDKKGMYKASNKNIVTILENDINLKGKIAYNLFSNRTMVKGDLPWRSVSDKVRGDIWQ… |
| A0A0V8QKA2 | 4-101 | EIREHLATTQKGQTANTIGNCMIVFRADSMLRGVIRLNLLTERVDIVRDLGWRRMTAALTDTDMKYLRLYFEENYGITSNPKIEDAL… |
| A0A1F8HZH0 | 403-532 | None |
| A0A1G7G4Z0 | 134-243 | None |
| A0A6L5Z6T4 | 54-172 | None |
| F7X235 | 61-177 | None |
| T0CQT1 | 108-222 | None |
| U7UCU8 | 1-104 | None |
| A0A7R7DB80 | 328-430 | None |
| A0A317J441 | 257-360 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.