DPCstruct | MC4600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 81 ± 11 aa |
| Standard deviation of domain lengths | 10.78 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 59.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H2EES5 | 90-163 | LIPNQGYLSESGASLVDRKLNLNVVPKTRVVRLVAESFNYARIDRQKAKLKKRIKEHYPSAHFNRMSLPLKTGS |
| A0A183I386 | 1-80 | MESITYRIGYLSEVGASLIDQKLKLNIVPQTNVVALAAPTFNYGRIDRAKSRTKQRIRTRYPEIGKRFHRIGLPPKVFLR |
| A0A820CUM5 | 74-152 | None |
| A0A1I7VJH3 | 1-77 | None |
| S4RF32 | 40-115 | None |
| A0A016WE06 | 1-80 | None |
| A0A822F072 | 94-173 | None |
| A0A6I8VPP1 | 38-124 | None |
| A0A016WD66 | 1-80 | None |
| A0A0B1TL25 | 45-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.