DPCstruct | MC460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 94 ± 5 aa |
| Standard deviation of domain lengths | 5.02 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A853ST66 | 264-350 | QARYLTGHWSHIFRDSKQQSTVRLVFDTTIRQIIAMDCRYGQGYVPASFDDVEDVLDSLLTANSDALDNPAEFGLEHVHEMPAWAQG |
| A0A6N7ZQC2 | 1-95 | MTDKHRYISTDYYWGHIFDEKIGEIMTQWVYDTQTKTLVGALIASNRSWVPASDEELADIEDSIKNANPDSLENPDDWGLSSTEEIP… |
| A0A0E3BG40 | 118-221 | None |
| A0A1H7DW37 | 1-93 | None |
| A0A848IMU5 | 8-100 | None |
| A0A845UEJ2 | 2-94 | None |
| A2SNG9 | 339-431 | None |
| A0A433CB42 | 10-106 | None |
| A0A7W6BZC3 | 9-117 | None |
| A0A521Z0P6 | 8-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.