DPCstruct | MC46
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 140 ± 12 aa |
| Standard deviation of domain lengths | 12.46 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 24.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E5JNK0 | 2-134 | KSVIRNVLAILIGVILGMVVNMGLIIMGSKFIPPPEGINPMDAESLKNNIHLFRLKHYLSPFLGHAGGTLAGAFTASKISANYHLAF… |
| A0A353B7S1 | 2-131 | RILRYLLAVLLGVLAGCFAVAAFQVVSVFAFPMPESVSIDNRQQMTEWLASLPVTAKLLVLAGWALAAFVGPLIGRLTAANRSIWPG… |
| A0A518C3T8 | 69-218 | None |
| A0A7C8CWW9 | 404-536 | None |
| A0A7V8V7B4 | 2-138 | None |
| A0A1H7BI50 | 1-128 | None |
| A0A2D5E802 | 30-198 | None |
| A0A6G7YZ06 | 18-151 | None |
| A0A4Q1K857 | 2-129 | None |
| A0A399WMR4 | 47-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.