DPCstruct | MC45995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 116 ± 26 aa |
| Standard deviation of domain lengths | 26.33 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 75.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01705 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3IW27 | 16-125 | MLSNSLRMTGLIVIANPTLPYYYGGNYYYWSHSHYNNRETKRSDRKKCLIHFNETHELDGIYLDENETIPEVVIWECKLDSYCCGME… |
| A0A016X193 | 51-158 | KVGSIQRTSMFRATVFGAAAGYLTFRAGRHFINDPSKPIMFDSRPYYWSSELQTPTEELPVQCVNKIDPQDPQFGRVYYANESRPTE… |
| A0A2G5T7F8 | 23-124 | None |
| A0A368GAG4 | 10-135 | None |
| A0A4U5MFL5 | 167-287 | None |
| A0A158R4F7 | 8-99 | None |
| A0A0N5DB61 | 8-96 | None |
| Q19664 | 36-154 | None |
| A0A368G0N4 | 12-169 | None |
| A0A0N4WBI9 | 10-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.