DPCstruct | MC45993
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 165 ± 22 aa |
| Standard deviation of domain lengths | 22.08 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3IU90 | 1-170 | MNDNYEKLENLSKRLPDGHELLKMIGEIFGGAGLCEQAVNCYLRCDMLNDALDVCIQLNQWDSAVQLSKTHNLRDVDALLGKYAEHL… |
| W8BU82 | 4-149 | LYHLERFDELEQCIDKLPEKSPLLAKIAEMLASVGMCTEAVKAYLKMGDPKSAVNACVNLRQWGEAVQLARKFDMPQIGNLLSKHAA… |
| A0A1I7V1E6 | 4-136 | None |
| A0A2H2IQW8 | 394-573 | None |
| A0A5N5TKV8 | 10-178 | None |
| A0A6L5D3K8 | 660-824 | None |
| A0A444SDS5 | 226-442 | None |
| A0A484BZQ1 | 579-747 | None |
| A0A812SPJ7 | 97-231 | None |
| A0A4V6A376 | 18-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.