DPCstruct | MC45991
Metacluster Properties and Pfam Annotations
| Number of structural domains | 230 |
|---|---|
| Mean domain length (aa) | 274 ± 67 aa |
| Standard deviation of domain lengths | 66.70 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 78.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.16 |
| Pfam Score | 99.71 |
| Assigned Pfam label(s) | CL0092- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3ITB7 | 33-272 | YLQGGSGSGFNHVIDKYENWKPRLFQCKGKRNVACERNSLNLGDVFILDCGLDLYVWMPPESGRLERIKGMSQAKSIRDQERHGKPK… |
| A0A2A9NNK9 | 24-305 | NVFYDTELLAVIHRHKFKSSGLVSTTVWIWQGRNSEKGEKEEHKIQELARRYGTQAELIRQHSEPPELIHSLGSRLAIRQGARSHWS… |
| A0A1D1W906 | 2-180 | None |
| A0A820AJR9 | 145-342 | None |
| A0A1Y2H7V4 | 479-871 | None |
| A0A6P8I496 | 777-1056 | None |
| A0A0C2MNB5 | 54-351 | None |
| F4Q3M1 | 16-170 | None |
| A0A7R9Q6C6 | 16-261 | None |
| A0A1D1W912 | 2-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.