DPCstruct | MC45990
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 118 ± 23 aa |
| Standard deviation of domain lengths | 23.07 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3ISJ6 | 47-140 | LSTTENPFQKQLQVKNAPIVADRQTLLNLEKNQVIIAEWPQPLKTRFYFNIIPEISITICSTCFRIFHTDDFEMIYLRSGGCPFCRS… |
| A0A7S1RJK9 | 4-101 | DLFVQKMLDAASYFVPGEPYQPVRIDRETLAELRSEEVYVVDFRKYSAALPIRYYRSMIPEVAIAVCGACGHFFHQETWELEFLQNK… |
| A0A1I7S260 | 214-329 | None |
| A0A7R8ZF05 | 3-91 | None |
| A0A7F8RD99 | 649-770 | None |
| A0A6J1WP24 | 2-135 | None |
| A0A183MKG8 | 17-116 | None |
| A0A819GHH9 | 53-170 | None |
| A0A7G2C3M4 | 17-120 | None |
| A0A7S0K1E4 | 200-372 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.