DPCstruct | MC4599
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 134 ± 10 aa |
| Standard deviation of domain lengths | 10.44 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183HXM5 | 1-129 | MAKVERHVENTKVESVAEKMLLSKSAVARQLKRMIGRVCENDYDKYQLLDERDRLMHRSRLKSTDVDNATVMQGFCRDMCPEKERYM… |
| A0A821BNJ5 | 6-127 | ATLITQLKERRAVTYQDRIKSLDIRDEIWRKYVELNKGSSFDANAAQRTGLCHDMCCERERLTREIQRLFKSYELDPDTRSLNHSLM… |
| S4RRN3 | 139-256 | None |
| A0A2G8KTB6 | 1-136 | None |
| A0A6I8NSY1 | 115-256 | None |
| A0A226E557 | 2-150 | None |
| A0A158Q6N8 | 121-247 | None |
| A0A0K0EQI1 | 1-141 | None |
| A0A0N4URN5 | 387-531 | None |
| A0A1X2I0R6 | 4-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.