DPCstruct | MC45989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 209 ± 31 aa |
| Standard deviation of domain lengths | 30.90 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00654 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090SPX9 | 1-177 | MTKREKIKQSLLAHVPKETINQFLSRDKTPISVLLLSCVVGIFAGLIGTLFELGVHFVTETRTDWLKDEIGSILPLWLLAFLISALL… |
| A0A0M3IRB9 | 84-311 | VAYNGTDIVGLSEHDDSYADDAAPPIFSKYGDFHTIDWQRDLARDRLRHKYILGHKKEFPFGTIYGMWDAGSGWICVLMVGLAAGAV… |
| A0A2U3DWI8 | 259-517 | None |
| A0A287N128 | 1-176 | None |
| A0A4W5KER9 | 10-228 | None |
| A0A183B965 | 1-173 | None |
| A0A6G0Z0W6 | 17-213 | None |
| A0A7S4EEY5 | 3-194 | None |
| A0A5J5ABW2 | 87-321 | None |
| A0A287N139 | 3-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.