DPCstruct | MC45978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 123 ± 12 aa |
| Standard deviation of domain lengths | 11.51 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 60.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3IBT0 | 6-133 | NFDVDREAGTRQIYHRYCIERAAVNMAHIFTTVSEITGLEAEHLLKRKPDILTPNGLNVVKFAALHEFQNLHAVAKEKIHDFIRGHF… |
| A0A7X8F744 | 2-117 | AEELNMVSKHSAEKRAAHLVDCFTTVSNITAKECTQLLERKPDIVTPNGFENGFVPQGKSFSPKRKEARTLLKKVAETLLGYPLGNN… |
| K5UND3 | 565-691 | None |
| A0A822HGW3 | 1-111 | None |
| A0A1V4L178 | 77-176 | None |
| A0A1C7MU22 | 212-333 | None |
| A0A4Z1SLT7 | 248-390 | None |
| A0A815EBZ7 | 1-120 | None |
| A0A2G5BFG9 | 648-785 | None |
| A0A5N5QG31 | 240-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.