DPCstruct | MC45971
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 330 ± 22 aa |
| Standard deviation of domain lengths | 22.04 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 27.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A416J9I7 | 2-338 | NIPYADFYDSEVKGNDEDVDAVSSATLNKTRTGSLVGGSYHEDPEGSEIRGVTFPVRVKKGTDLSSFKKVTDEDSVDITVTNRGQTN… |
| A0A3C0QSK6 | 56-376 | QDPAEIPSTGTIYGTMQIPYADFFKAEFEEANNSDVEVDAVSSATANKWKGNAVGSFDEEGNWTQGGLAAGTYYEEAEVGGKILGVV… |
| R6H5L4 | 2-286 | None |
| A0A1H9FV88 | 1-345 | None |
| A0A1H7NM16 | 28-332 | None |
| A0A415G3T0 | 65-409 | None |
| A0A844E4Z6 | 121-453 | None |
| A0A0D0RGI1 | 163-518 | None |
| A0A1C6AUH4 | 146-479 | None |
| A0A417IGL9 | 407-724 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.