DPCstruct | MC4597
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 189 ± 19 aa |
| Standard deviation of domain lengths | 18.65 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 42.09 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | PF06465- PF06461 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183HWR8 | 4-173 | FVLLVNYASENMQQDWQQMHPNNDDFSSSYSGDSGHSDGEGEDDEFDSNQQGKKRHRDRGDEKLPPLLARVNGQLEVLGFNPRQRRA… |
| A0A448WMA8 | 1-145 | MSAKDEDDEEYDERQAGNAGDTLVTGRRLRREREGKMPPLLSRVNGQLEVFGFNSRQRRSFLNAVMRYGLPPTDQSVLSAWNVRDLK… |
| A0A0A9DE14 | 1-169 | None |
| A0A183NDW9 | 555-760 | None |
| A0A0S7J8W7 | 26-223 | None |
| A0A2H1CBC9 | 146-326 | None |
| A0A0B2SQ32 | 11-211 | None |
| A0A817F8U5 | 144-332 | None |
| A0A1S4CTZ5 | 104-292 | None |
| A0A1U8D4V2 | 240-433 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.