DPCstruct | MC45968
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 146 ± 24 aa |
| Standard deviation of domain lengths | 24.25 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R7ZTV1 | 2-141 | QEKLFQLVCPTCKQEFYIKRDTIINHEIDENLVPLVTNRSLFVHTCENCKTTFPLDYPVLYYFPKQRMYIGYQLKGEGSITSTYIEA… |
| A0A255UBV2 | 2-122 | SKLVKIAIECPKCSHQYSGDFFRTIWGENEANRSMVMEDRINIAKCPSCGHQFHLPLAMMYVDVQKGFAVWWEPNHDPGIDSDSASY… |
| A0A7X8FUT8 | 2-165 | None |
| J9G6J3 | 1-170 | None |
| A0A0P6YMA1 | 3-143 | None |
| D0LNG8 | 1-182 | None |
| A0A497ABT9 | 1-152 | None |
| A0A7C5EX08 | 28-157 | None |
| A0A838IFR9 | 7-150 | None |
| A0A521U1T2 | 3-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.