DPCstruct | MC45965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 5.16 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 54.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151HIH8 | 1-78 | MAPSIRGVSLFIQDVRNAPSSSREQARVLQELSKIRQRFAHPKKPLTGYEKKKCLTKLLYIHLLGYPVDIGHAEAISL |
| A0A7J6LTE6 | 1-74 | MTKLRELIRQVRACKTQSEEKAVVARECAMIRQSFKDGDPDHRSRNVAKLVYIHMLGYPTHFGQMDCLKLIASS |
| A0A167F8Q4 | 1-83 | None |
| A0A812DJD1 | 81-153 | None |
| R9PDI9 | 376-452 | None |
| A0A2I0LDN1 | 4-89 | None |
| A0A179FVD6 | 15-101 | None |
| A0A3R6WPV8 | 502-574 | None |
| A0A7J7GGL3 | 113-188 | None |
| A0A817J3T6 | 12-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.