DPCstruct | MC4596
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 128 ± 8 aa |
| Standard deviation of domain lengths | 8.47 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19432 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183HVY1 | 1-113 | IAFVVRDEGNPQSFTIQYDEGDTRSYTSPERDLILTSLIDGSRASGNQCLFVTCSKYDRALRIIPYKFLLDEDTESQCMRHIISVPP… |
| A0A4C1SLJ7 | 43-165 | SVCTLRPLIDVFALIRDKDNLQKFCIEYKNGIVRSYTTNDRDSLLATLLDAVRSSGNQDVHIRIGNTPRGKRYVPLSSTVDEETETN… |
| A0A183LH23 | 85-206 | None |
| A0A820ECY9 | 1-150 | None |
| A0A482VMC3 | 272-399 | None |
| A0A7R9ANP8 | 153-283 | None |
| A0A7G2CDZ9 | 127-255 | None |
| A0A6J0YW09 | 274-396 | None |
| A1Z7S0 | 281-412 | None |
| A0A2R7VRR3 | 17-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.