DPCstruct | MC45954
Metacluster Properties and Pfam Annotations
| Number of structural domains | 251 |
|---|---|
| Mean domain length (aa) | 133 ± 18 aa |
| Standard deviation of domain lengths | 18.45 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H0BEJ7 | 17-145 | SLSSFFLYSLFFIPYSMPTMATEYKLLQKLPLSGSTDIQKVPNASVYIKGLFNLTIAIAGVLAVIKIIFGGIQYMSTDAFGAKNEAK… |
| A0A3C1TKQ6 | 82-190 | AGQAITTISFGGRTQFSNVGEFIKFIYQYGFIVGSVVAVMVIIVAGVMYIFSGGNSDTVGQAKKKIMGSVIGLILMALSYTILNTIN… |
| A0A7C1DCY4 | 8-191 | None |
| A0A2G9YE82 | 1-115 | None |
| A0A7T9BT99 | 238-373 | None |
| A0A7C1D8Q7 | 15-141 | None |
| A0A7T5REN7 | 11-137 | None |
| A0A1F5NU92 | 1145-1250 | None |
| A0A0G0GUW0 | 5-107 | None |
| A0A7Y4QDQ7 | 8-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.