DPCstruct | MC45950
Metacluster Properties and Pfam Annotations
| Number of structural domains | 101 |
|---|---|
| Mean domain length (aa) | 146 ± 18 aa |
| Standard deviation of domain lengths | 18.32 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 19.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02520 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K0E3A0 | 64-204 | AIPKYPNTIPQFLKNLNTTELENFLYIVLDVKSTKSEIENNLNKWVEKQSDNIKKEYNIFKAKEELKKDKFEKYHEFISSKFFPDAK… |
| Q7YTI8 | 9-178 | VFSLAAVIQSFTIGVSTELPTVTTVAPVAQVEPITVPTRTQNTYNAKIEQRLPFLRGIDELNRQEFFSIIQNDKLSKSEIWENVEKW… |
| A0A0D8XQN7 | 21-160 | None |
| G0P6U8 | 41-156 | None |
| A0A7E4VWL6 | 164-338 | None |
| A0A090LV07 | 93-234 | None |
| A0A090LNY1 | 2-122 | None |
| A0A016U9V3 | 23-180 | None |
| A0A0N4ZKP1 | 186-317 | None |
| A0A2A6CVL7 | 43-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.