DPCstruct | MC4595
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 97 ± 8 aa |
| Standard deviation of domain lengths | 7.83 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 56.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7SMJ3 | 663-755 | ECGQTCRNLAEGQKHMIGHIRAIRLKCSLCDVGAFFCADIRKHLMYRYCENIHLAPREMVQSGTPCMNAQTADKLIKIADPSNPGRA… |
| A0A183HVV8 | 1-97 | MQCGDIIANISEGRRHAVSHLRIMRLRCSLCGCGSFFCSDMRTHLQYRHCDKLHLAPRGYVLPGNVLPCMTQRQADDLTRVVDAMKP… |
| A0A0N5AF07 | 867-963 | None |
| A0A0N5AF06 | 24-120 | None |
| A0A0N4VHN5 | 81-175 | None |
| A0A183FQB7 | 163-256 | None |
| A0A2A2KH17 | 746-842 | None |
| A0A0N4XVG3 | 126-226 | None |
| A0A0K0D824 | 1-97 | None |
| A0A3P7MH92 | 136-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.