DPCstruct | MC45946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 90 ± 9 aa |
| Standard deviation of domain lengths | 8.51 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q21211 | 1-95 | MTKCSIIIGIFLIAAINGQASKRRIQYESVSQFLFHNSKLCGDPFSDAVWLPVLDLCSIECEITSEYCVENEELTQQCKKLPEDCQA… |
| A0A0R3PFH6 | 3-93 | FLRITLVLLFSALFCCVKCEDDKYLITLVYRFVFANEALCGDPFADPEWVPAANDCFVDCDPTLYMCMIHMETSIQKCKFFSKECQS… |
| A0A0K0DZS0 | 11-97 | None |
| A0A6V7WLQ3 | 21-119 | None |
| A0A2K6WMK1 | 28-112 | None |
| A0A0D8XT20 | 1-102 | None |
| A0A368GHT3 | 2-93 | None |
| A0A2A6D0L6 | 2-101 | None |
| A0A4E9ESE1 | 1-92 | None |
| A0A0N4UC27 | 19-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.