DPCstruct | MC45945
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 123 ± 13 aa |
| Standard deviation of domain lengths | 13.26 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17305 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q19759 | 82-195 | AKHIRCWEEVDDDDQSKGYTLSEPIYELCSFMPDPKDYNKFYVNGVDMESDVYTNFLAMYANALEGYAVLNVCIQEAFQFHAAKHPS… |
| Q11093 | 13-125 | KLIRCWEPIDSDDLSKGHTMSDPVYQLCSYMPSPKDYNKFHVNGVQMDSDDYTTILTMFANQLPGYAVLNVCLQEAFQFHKANHPSQ… |
| A0A4U8UMC8 | 5-114 | None |
| A0A4U5NZ95 | 14-137 | None |
| A0A4X3P933 | 20-132 | None |
| A8Y322 | 76-208 | None |
| A8Y2Y2 | 146-294 | None |
| A0A1I8AI02 | 88-218 | None |
| A0A1I7TNE1 | 25-156 | None |
| A0A7E4URZ7 | 14-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.