DPCstruct | MC45944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 169 ± 16 aa |
| Standard deviation of domain lengths | 15.92 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 66.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q09368 | 1-161 | MQFSLSYLISIFYIILITSETTAFSPKRPNLYIWLAQNSYICDPTLLNKRTHRFLTPWESVRLRCSCGDPLATKSACGRKHGNSNQK… |
| A0A1I8BMF5 | 12-174 | FILLIQQLNKICMETLSTANPVERRPPNLYKWIEENAHICTIVPVNGESLVSFLSEEEGKKCSLCPELGINEVPTMACAVEVTPNNV… |
| A0A158QXT9 | 8-150 | None |
| A0A4U8UKZ7 | 64-227 | None |
| A0A0B2W3C4 | 8-183 | None |
| W2SQR7 | 4-158 | None |
| Q93787 | 1-197 | None |
| A0A7E4V3W7 | 4-175 | None |
| A0A6G0V6A2 | 1-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.