DPCstruct | MC4593
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 142 ± 14 aa |
| Standard deviation of domain lengths | 14.20 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A158Q2H9 | 29-172 | RYFSKWLKEYKERFLERRHNPFCENSIQRILERDKLNKVDWKLIYYDVSSSHVSDLFAFFTSFLLIFLAYSSYEHYNYIRGLSFRHS… |
| A0A183V1E7 | 7-136 | FSASGVARSYAWDRLDAKQWLLIYRDSNASRTYALAAILFPTASIVAFILFIDFFKNGPRNRTAFVQKLCKDATELGALAAFPIVCF… |
| A0A183F2B8 | 3-153 | None |
| A0A0D8Y9T0 | 2-164 | None |
| A0A3P6RDS5 | 1-118 | None |
| A0A182DXA7 | 67-225 | None |
| A0A7E4WDK9 | 22-151 | None |
| A0A6V7UYH3 | 63-212 | None |
| A0A0D6LMM0 | 113-261 | None |
| A0A2G9V5I1 | 27-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.