DPCstruct | MC45929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 371 ± 47 aa |
| Standard deviation of domain lengths | 46.82 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 27.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J6Y2M8 | 2-355 | EEEVVAILKSRDIPFKYEDIRTALEDPGTRDWVRKHLGDDTLLSREELTLYSKIEASAGLDAIVQGSEFSGTRPVLDDEIKTATESL… |
| K2RZH7 | 7-365 | LNHLLTVLRDRRVPLTRDDVQWAFESAKTQNDAVAWVNEYLGSNTLLSKEELELYETLCAQDESIKDRADLPDVLPYQDEDIRTAIE… |
| A0A5N5WJW7 | 339-698 | None |
| G0S3M4 | 3-369 | None |
| Q6MFU6 | 47-406 | None |
| A0A232LNQ6 | 405-828 | None |
| A0A072NV98 | 1-429 | None |
| A0A1Y2EA84 | 55-369 | None |
| A0A3A2ZIC1 | 4-320 | None |
| F7WAW6 | 101-462 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.