DPCstruct | MC4592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3 |
|---|---|
| Mean domain length (aa) | 116 ± 5 aa |
| Standard deviation of domain lengths | 5.35 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 71.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 51.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09766 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4JSN8 | 614-735 | EDSQDDESDSDAEEEQTTKRRRPTLGVQLDDKRKEMLKRHPLSVTIDLKCKDDNVLHLTFYYLMNLNVMTVKAKVTTAVEMTTAVSA… |
| A0A0B2VFS0 | 983-1091 | VERDRSPSRLRRRRNTLSEQMTRKRDAVLATHPIHLILDITCSDGITVSLQLQYIQELRSIGVLAKLRGSSLPFHENLLCDESVLME… |
| A0A7F8Q7G9 | 379-495 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.