DPCstruct | MC45917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 205 ± 26 aa |
| Standard deviation of domain lengths | 25.57 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 13.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847WU01 | 2-212 | DFIGYSDDFRYFAFEEFGIQDGSGFAYSNVYVIDLPADRWLAKTPIRVQAEDEATGLGAVRAEALGKAQSHIETLNISVPADLIVLH… |
| A0A511MWX0 | 9-210 | LLTAGSAFAADQSTLQFLGFSKDGKYAAYEQYGIHDGSGFPFSEIVVLNVPQNKAILTVKKSLQEDGAEVKDARSQALKAATLNKYG… |
| A0A2E5HM09 | 6-190 | None |
| A0A3R9RJ02 | 4-180 | None |
| A0A432TGJ9 | 164-372 | None |
| G9EPZ7 | 5-225 | None |
| A0A850B5R3 | 70-275 | None |
| A0A3B0T9E2 | 14-255 | None |
| A0A7I6GW76 | 2-188 | None |
| A0A2W4NPQ9 | 13-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.