DPCstruct | MC4591
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 127 ± 15 aa |
| Standard deviation of domain lengths | 14.79 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.95 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 66.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00992 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A238BKN8 | 41-154 | YDLEKRHERQLYDLKELHEREKQPKINVASKFDRHFDRRSYGDRRIIFEKPPVEKPLPIIHGTARPPPEWGRTENEELEQLRKIIEP… |
| A0A183HU34 | 1-123 | LKELHEREKQVARHRALQRGLDPNEAAASPHPPKINVASKFDRHFDRRSYGDRRIIFEKPPVEKPLPIIHGTARPPPEWGRTENEEL… |
| A0A183TX17 | 66-188 | None |
| A0A0B2VC98 | 359-481 | None |
| A0A0M3IMZ5 | 160-284 | None |
| A0A0R3QGF0 | 1-125 | None |
| G0MSR7 | 1-121 | None |
| A0A182EN82 | 176-298 | None |
| A0A550J6C5 | 1-173 | None |
| A0A811KH00 | 256-379 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.